Zfp566 Antibody PA5-70376 from Thermo Fisher Scientific | Biocompare.com

Supplier Images

WB

Western blot analysis of Zfp566 on rat spleen tissue lysate. The sample was probed with a Zfp566 polyclonal antibody (Product # PA5-70376) using a primary antibody dilution of 1.0 µg/mL.
WB

Western blot analysis of Zfp566 on rat spleen tissue lysate. The sample was probed with a Zfp566 polyclonal antibody (Product # PA5-70376) using a primary antibody dilution of 1.0 µg/mL.

Be the first to write a review!

Supplier Page from
Thermo Fisher Scientific for
Zfp566 Antibody

Thermo Fisher Scientific's Zfp566 Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Zfp566 Antibody was generated using Zfp566 as the antigen and it reacts with Rat.

Product Specs
ItemZfp566 Antibody
CompanyThermo Fisher Scientific
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberPA5-70376
Quantity100 µL
ApplicationsWestern Blot
Conjugate/TagUnconjugated
FormatPBS with 2% sucrose and 0.09% sodium azide
ReactivityRat
TargetZfp566
IsotypeIgG
HostRabbit
Immunogensynthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI
NCBI Full Gene Namezinc finger protein 566
NCBI Gene AliasesRGD1563239
ClonalityPolyclonal
PurityAffinity chromatography
Storage Temperature-20° C, Avoid Freeze/Thaw Cycles
Antibody TypePrimary
Concentration0.5 mg/mL
Storage-20° C, Avoid Freeze/Thaw Cycles

Add to Compare List

Thermo Fisher Scientific

Thermo Fisher Scientific

Thermo Fisher Scientific

81 Wyman Street

Waltham, MA 02451

United States

Phone: 800-678-5599
Fax: 800-331-2286

Company Profile

Website: www.thermofisher.com

Be the First to Write a Review!